PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0008s0026.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARR-B
Protein Properties Length: 537aa    MW: 59172.9 Da    PI: 5.1707
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0008s0026.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.22.1e-29203256155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+r++W+peLH++Fv+av+qL G+ekA+Pk+il++m+v+gLt+e+v+SHLQkYRl
  Sphfalx0008s0026.1.p 203 KARVVWSPELHKQFVQAVNQL-GIEKAVPKRILDVMNVQGLTRENVASHLQKYRL 256
                           68*******************.********************************8 PP

2Response_reg83.85.3e-28321401109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdDepl +++l ++l++ +y +v+++  ++eal ll+e++  +Dl++ D+ mp+mdG++ll+ i  e  +lp+i+++a ge +++ 
  Sphfalx0008s0026.1.p  32 VLVVDDEPLCLMILDRMLRQCKY-NVTTCNLATEALSLLRENRnyFDLVISDVYMPDMDGFKLLEAIGLEL-DLPVIMMSAVGETDLVM 118
                           89*********************.***************999999**********************5544.6**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+  eel++
  Sphfalx0008s0026.1.p 119 KGITHGACDYLLKPVRLEELRN 140
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.69E-3828159IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.5E-4229166No hitNo description
SMARTSM004481.3E-3030142IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.99431146IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.9E-2532141IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.07E-2833146No hitNo description
PROSITE profilePS5129411.19200259IPR017930Myb domain
SuperFamilySSF466895.38E-20201260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-30202261IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-25203256IPR006447Myb domain, plants
PfamPF002493.1E-8205255IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MDMSGGGDLA WTQRNKTEMA IPLGTFPEGL RVLVVDDEPL CLMILDRMLR QCKYNVTTCN  60
LATEALSLLR ENRNYFDLVI SDVYMPDMDG FKLLEAIGLE LDLPVIMMSA VGETDLVMKG  120
ITHGACDYLL KPVRLEELRN IWQHVIRRRV PVKDLHREEG SGEWDDSAYP HDSTADTDHS  180
FRKRKERVDD EIQRAEDLNN LKKARVVWSP ELHKQFVQAV NQLGIEKAVP KRILDVMNVQ  240
GLTRENVASH LQKYRLYLKR LSGVNPQPYP VASFQAAKNG SSGGVMQIQP GGRAAASSSS  300
GSKGWILGGV GLGRNVVQKD TVDRGSLQAQ LQQKHQQQQL ARTFEGLNQP TRDVAFTDLQ  360
RMGSNDLDLL MKTEYDASGQ PLDIANDQLP VLGNLNVLEQ FDLSGLIDLR EGENPVTMSN  420
LGTMSTHNNL NAITMENLRR AEDMGSLTSL KPGNGLAGGL GFGRPRGGDD WAPLESTGLA  480
EHLALRKFGG EFTSASCFSS VDTSSHEGIS ETSFKDYNDF GGPSDLLTPP HDLPLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-22202262464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotB8B3I41e-97ORR22_ORYSI; Two-component response regulator ORR22
SwissprotQ5SML52e-97ORR22_ORYSJ; Two-component response regulator ORR22
STRINGPP1S31_291V6.11e-161(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-97response regulator 2